PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g075400.1
Common NameMTR_2g075400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family BES1
Protein Properties Length: 518aa    MW: 57133.5 Da    PI: 9.3589
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g075400.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221952.6e-6021171116
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r ptwkErEnnkrRERrRRaiaaki++GLR++Gn++lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kple+++++g s+ asp+ss+
  Medtr2g075400.1   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPLENMDMVGGSSAASPCSSY 95 
                      5899*****************************************************************************************9 PP

           DUF822  95 qsslkssalaspvesysaspks 116
                      + s+ ss+++sp +s  a  ++
  Medtr2g075400.1  96 HPSPGSSSFPSPSSSPYAANRN 117
                      9888888777777664443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.3E-574131IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FSGLRMYGNF RLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKGCKPLENM DMVGGSSAAS PCSSYHPSPG SSSFPSPSSS PYAANRNADG  120
NSLIPWLKNL STASSSGSSP KLPHPYFHSG SISAPVTPPL SSPTSRTPRL NADFDDQSAR  180
PGWTGQHYSF LPSSGPPSPA RQIVDPEWFA GIKLPHASPT SPTFNLVSRS PFAFKEDGFS  240
GGGSRMWTPG QSGACSPAIA AGFDQTADIP MSEAISDEFA FGSNTFGIVK PWEGERIHEE  300
FVADDLELTL GNSKTRNVNI NLCCKPPRTP LQVIGSSVAR YNKSHMIEVQ GLLRSKTKKK  360
HKYNQETKGV IRQVKQMKVV FGLQEVLEVV NNGIEVLPTN SHIDGKNKDG KTLFYIHKCV  420
GNKVFEKIVD ANTSMEVWDT LVKYDGGDAK VKKMDEKIAY YFSTLVTITN QMKQCSDIMT  480
HQVEDIQGTL EAHEMKITKR GNERQEEQAN FSKFKKD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.94022e-71leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2076010.0AC207601.5 Medicago truncatula chromosome 2 BAC clone mth2-45c5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003596274.20.0brassinazole-resistant 1 protein
SwissprotQ9ZV881e-122BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLG7IR040.0G7IR04_MEDTR; Brassinazole-resistant 1 protein
STRINGGLYMA13G34170.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26613375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.16e-97BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]